PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013596283.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 268aa    MW: 30670.5 Da    PI: 9.1454
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013596283.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.32e-192067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll+d+v+++G g+W+++a+  g++R +k+c++rw +yl
   XP_013596283.1 20 KGPWTAEEDRLLIDYVRLHGEGRWNSVAKLAGLKRNGKSCRLRWVNYL 67
                     79********************************************97 PP

2Myb_DNA-binding52.61e-1673117147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T+ E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
   XP_013596283.1  73 RGQITPHEETIILELHAKWGNR-WSTIARSLP-GRTDNEIKNYWRTH 117
                      7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.9551571IPR017930Myb domain
SuperFamilySSF466891.04E-3017114IPR009057Homeodomain-like
SMARTSM007175.6E-171969IPR001005SANT/Myb domain
PfamPF002494.5E-182067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-242174IPR009057Homeodomain-like
CDDcd001671.29E-122267No hitNo description
PROSITE profilePS5129419.68272122IPR017930Myb domain
SMARTSM007174.7E-1572120IPR001005SANT/Myb domain
PfamPF002494.9E-1473117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2475121IPR009057Homeodomain-like
CDDcd001671.21E-1077118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MSLWGVMGAG WGMVEEGWRK GPWTAEEDRL LIDYVRLHGE GRWNSVAKLA GLKRNGKSCR  60
LRWVNYLRPD LKRGQITPHE ETIILELHAK WGNRWSTIAR SLPGRTDNEI KNYWRTHFKK  120
KTKFPTNNAE KTKNRILKRQ QFQQLRQMEL QQEQQTLQFN QIDMKKIMSL IEDDNNNDNN  180
FSSSSSGSSG EGGAFYVPHQ IPHSTTSSGY DPNGNGFFPV PIPEANVNED YTVWDGLWNL  240
DVEGQGSFGG GACVPRKHCF PNVSIPFC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-262012227128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5502980.0AY550298.1 Arabidopsis thaliana MYB transcription factor (At3g24310) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596283.10.0PREDICTED: myb-related protein 305
TrEMBLA0A0D3D5390.0A0A0D3D539_BRAOL; Uncharacterized protein
STRINGBra015029.1-P1e-161(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31072766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.11e-130myb domain protein 305